PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK22268.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 312aa    MW: 34802.5 Da    PI: 7.0616
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK22268.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.4e-1761104146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE+ l++d++ ++G++ W++Ia++++ gRt++++k++w++
        PK22268.1  61 RGNLTPEEQILILDLHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 104
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071788157IPR001005SANT/Myb domain
PROSITE profilePS500904.739555IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.7E-73558IPR009057Homeodomain-like
SuperFamilySSF466891.63E-2241116IPR009057Homeodomain-like
PROSITE profilePS5129425.45256110IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2459109IPR009057Homeodomain-like
SMARTSM007174.9E-1560108IPR001005SANT/Myb domain
PfamPF002491.6E-1561104IPR001005SANT/Myb domain
CDDcd001671.10E-1265104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MTVMSSEEVR GLLKKTLFSS TTSLAMVKAD XNLLAKRSGL RRTGKSCRLR WLNYLKPDVK  60
RGNLTPEEQI LILDLHSKWG NRWSKIAQYL PGRTDNEIKN YWRTRVQKQA KHLKIDAEST  120
AFQEIIRNFW MPRLLEKIEN SPCTSAIPIL QTSSPAVGVP IPSDTSTTAS TGSHLQYYAS  180
SSTHLLSGHS TNELNNMTAG LAMTEQSSDS ESMNFSQISD HFNEYPTSSP LQPANLHTNN  240
AYNSFLEACS YGGGSGESNG YDNHMNSNQS TVLEGGLGHP VESCHVAGIN WPDNDFFAGV  300
WNTDDQLWQY KN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-174211040108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094742.11e-97Transcription factor
TrEMBLW9QXC41e-97W9QXC4_9R
STRINGPOPTR_0012s05200.12e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.18e-62myb domain protein 116